CKB polyclonal antibody
  • CKB polyclonal antibody

CKB polyclonal antibody

Ref: AB-PAB28405
CKB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CKB.
Información adicional
Size 100 uL
Gene Name CKB
Gene Alias B-CK|CKBB
Gene Description creatine kinase, brain
Storage Conditions Store at 4 C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CKB.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1152
Iso type IgG

Enviar un mensaje


CKB polyclonal antibody

CKB polyclonal antibody