MPST polyclonal antibody
  • MPST polyclonal antibody

MPST polyclonal antibody

Ref: AB-PAB28403
MPST polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MPST.
Información adicional
Size 100 uL
Gene Name MPST
Gene Alias MGC24539|MST|TST2
Gene Description mercaptopyruvate sulfurtransferase
Storage Conditions Store at 4 C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq AVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPD
Form Liquid
Recomended Dilution Western Blot (1:100-1:250)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MPST.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4357
Iso type IgG

Enviar un mensaje


MPST polyclonal antibody

MPST polyclonal antibody