PLEK2 polyclonal antibody
  • PLEK2 polyclonal antibody

PLEK2 polyclonal antibody

Ref: AB-PAB28394
PLEK2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PLEK2.
Información adicional
Size 100 uL
Gene Name PLEK2
Gene Alias -
Gene Description pleckstrin 2
Storage Conditions Store at 4 C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq ISLSTVELSGTVVKQGYLAKQGHKRKNWKVRRFVLRKDPAFLHYYDPSKEENRPVGGFSLRGSLVSALEDNGVPTGVKGNVQGNLFKVITKDDTHYYIQASSKAERAEWI
Form Liquid
Recomended Dilution Western Blot (1:250-1:500)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PLEK2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26499
Iso type IgG

Enviar un mensaje


PLEK2 polyclonal antibody

PLEK2 polyclonal antibody