AMOTL1 polyclonal antibody
  • AMOTL1 polyclonal antibody

AMOTL1 polyclonal antibody

Ref: AB-PAB28392
AMOTL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant AMOTL1.
Información adicional
Size 100 uL
Gene Name AMOTL1
Gene Alias JEAP
Gene Description angiomotin like 1
Storage Conditions Store at 4 C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq SPSACYSPSSPVQVLEDSTYFSPDFQLYSGRHETSALTVEATSSIREKVVEDPLCNFHSPNFLRISEVEMRGSEDAAAGTVLQRLIQEQLRYGTPTENMNLLAIQHQATGSAGPAHPTNNFSSTENLTQEDPQMVYQSARQEPQGQEHQV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human AMOTL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 154810
Iso type IgG

Enviar un mensaje


AMOTL1 polyclonal antibody

AMOTL1 polyclonal antibody