GSR polyclonal antibody
  • GSR polyclonal antibody

GSR polyclonal antibody

Ref: AB-PAB28385
GSR polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GSR.
Información adicional
Size 100 uL
Gene Name GSR
Gene Alias MGC78522
Gene Description glutathione reductase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GFPSCEGKFNWRVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDPKPTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GSR.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2936
Iso type IgG

Enviar un mensaje


GSR polyclonal antibody

GSR polyclonal antibody