IFNGR2 polyclonal antibody
  • IFNGR2 polyclonal antibody

IFNGR2 polyclonal antibody

Ref: AB-PAB28384
IFNGR2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IFNGR2.
Información adicional
Size 100 uL
Gene Name IFNGR2
Gene Alias AF-1|IFGR2|IFNGT1
Gene Description interferon gamma receptor 2 (interferon gamma transducer 1)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq ASPSAGFPMDFNVTLRLRAELGALHSAWVTMPWFQHYRNVTVGPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYWEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHLSNIS
Form Liquid
Recomended Dilution Western Blot (1:100-1:250)
Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IFNGR2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3460
Iso type IgG

Enviar un mensaje


IFNGR2 polyclonal antibody

IFNGR2 polyclonal antibody