LUM polyclonal antibody
  • LUM polyclonal antibody

LUM polyclonal antibody

Ref: AB-PAB28382
LUM polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LUM.
Información adicional
Size 100 uL
Gene Name LUM
Gene Alias LDC|SLRR2D
Gene Description lumican
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTF
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LUM.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4060
Iso type IgG

Enviar un mensaje


LUM polyclonal antibody

LUM polyclonal antibody