RESP18 polyclonal antibody
  • RESP18 polyclonal antibody

RESP18 polyclonal antibody

Ref: AB-PAB28328
RESP18 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RESP18.
Información adicional
Size 100 uL
Gene Name RESP18
Gene Alias -
Gene Description regulated endocrine-specific protein 18
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PTKTTESPLAKVNRDQCFTSEVVSKALKQEVANPVKITYRCSYGGLDMMQAPGPSKEEIIYKIMRLLWATS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant RESP18.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 389075
Iso type IgG

Enviar un mensaje


RESP18 polyclonal antibody

RESP18 polyclonal antibody