LOC728597 polyclonal antibody
  • LOC728597 polyclonal antibody

LOC728597 polyclonal antibody

Ref: AB-PAB28327
LOC728597 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LOC728597.
Información adicional
Size 100 uL
Gene Name LOC728597
Gene Alias -
Gene Description doublecortin domain-containing protein ENSP00000382097-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KEPCKYDGIPPKTQDSVYYAKEEKKKTLAEPLVQRGAEGDVYKAPTPSKETQGALDVKEEHNVQLEVPVDQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant LOC728597.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 728597
Iso type IgG

Enviar un mensaje


LOC728597 polyclonal antibody

LOC728597 polyclonal antibody