DUSP23 polyclonal antibody
  • DUSP23 polyclonal antibody

DUSP23 polyclonal antibody

Ref: AB-PAB28324
DUSP23 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DUSP23.
Información adicional
Size 100 uL
Gene Name DUSP23
Gene Alias DUSP25|FLJ20442|LDP-3|MOSP|RP11-190A12.1|VHZ
Gene Description dual specificity phosphatase 23
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq IVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant DUSP23.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54935
Iso type IgG

Enviar un mensaje


DUSP23 polyclonal antibody

DUSP23 polyclonal antibody