TSKS polyclonal antibody
  • TSKS polyclonal antibody

TSKS polyclonal antibody

Ref: AB-PAB28322
TSKS polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TSKS.
Información adicional
Size 100 uL
Gene Name TSKS
Gene Alias TSKS1
Gene Description testis-specific kinase substrate
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LTPACPSCQRLHKKILELERQALAKHVRAEALSSTLRLAQDEALRAKNLLLTDKMKPEEKMATLDHLHLKMCSLHDHLSNLPLEGSTGTMGGGSSAGT
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant TSKS.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 60385
Iso type IgG

Enviar un mensaje


TSKS polyclonal antibody

TSKS polyclonal antibody