UBE2L3 polyclonal antibody
  • UBE2L3 polyclonal antibody

UBE2L3 polyclonal antibody

Ref: AB-PAB28318
UBE2L3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant UBE2L3.
Información adicional
Size 100 uL
Gene Name UBE2L3
Gene Alias E2-F1|L-UBC|UBCH7|UbcM4
Gene Description ubiquitin-conjugating enzyme E2L 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant UBE2L3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7332
Iso type IgG

Enviar un mensaje


UBE2L3 polyclonal antibody

UBE2L3 polyclonal antibody