C14orf100 polyclonal antibody
  • C14orf100 polyclonal antibody

C14orf100 polyclonal antibody

Ref: AB-PAB28315
C14orf100 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C14orf100.
Información adicional
Size 100 uL
Gene Name C14orf100
Gene Alias CDA06|HSPC213|HSPC327|JAMP
Gene Description chromosome 14 open reading frame 100
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LYIRSCRVLMLSDWYTMLYNPSPDYVTTVHCTH
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant C14orf100.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51528
Iso type IgG

Enviar un mensaje


C14orf100 polyclonal antibody

C14orf100 polyclonal antibody