STC2 polyclonal antibody
  • STC2 polyclonal antibody

STC2 polyclonal antibody

Ref: AB-PAB28313
STC2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant STC2.
Información adicional
Size 100 uL
Gene Name STC2
Gene Alias STC-2|STCRP
Gene Description stanniocalcin 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq SAIQKPPTAPPERQPQVDRTKLSRAHHGEAGHHLPEPSSRETGRGAKGERGSKSHPNAHARGRVGGLGAQGPSGSSEWEDEQSEYSDIRR
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant STC2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8614
Iso type IgG

Enviar un mensaje


STC2 polyclonal antibody

STC2 polyclonal antibody