CYP2D6 polyclonal antibody
  • CYP2D6 polyclonal antibody

CYP2D6 polyclonal antibody

Ref: AB-PAB28309
CYP2D6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CYP2D6.
Información adicional
Size 100 uL
Gene Name CYP2D6
Gene Alias CPD6|CYP2D|CYP2D@|CYP2DL1|MGC120389|MGC120390|P450-DB1|P450C2D|P450DB1
Gene Description cytochrome P450, family 2, subfamily D, polypeptide 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant CYP2D6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1565
Iso type IgG

Enviar un mensaje


CYP2D6 polyclonal antibody

CYP2D6 polyclonal antibody