SGMS1 polyclonal antibody
  • SGMS1 polyclonal antibody

SGMS1 polyclonal antibody

Ref: AB-PAB28308
SGMS1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SGMS1.
Información adicional
Size 100 uL
Gene Name SGMS1
Gene Alias MGC17342|MOB|MOB1|SMS1|TMEM23
Gene Description sphingomyelin synthase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ASTMKEVVYWSPKKVADWLLENAMPEYCEPLEHFTGQDLINLTQEDFKKPPLCRVSSDNGQRLLDMIETLKMEHHLEAHKNGHANGHLNIGVDIPTPDGSFSIKIKPNGMPNGYRKEMIKIPM
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant SGMS1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 259230
Iso type IgG

Enviar un mensaje


SGMS1 polyclonal antibody

SGMS1 polyclonal antibody