CEACAM16 polyclonal antibody
  • CEACAM16 polyclonal antibody

CEACAM16 polyclonal antibody

Ref: AB-PAB28301
CEACAM16 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CEACAM16.
Información adicional
Size 100 uL
Gene Name CEACAM16
Gene Alias CEAL2
Gene Description carcinoembryonic antigen-related cell adhesion molecule 16
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq VPVPTKPTEGQDVTLTVQGYPKDLLVYAWYRGPASEPNRLLSQLPSGTWIAGPAHTGREVGFPNCSLLVQKLNLTDTGRYTLKTVTVQGKT
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant CEACAM16.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 388551
Iso type IgG

Enviar un mensaje


CEACAM16 polyclonal antibody

CEACAM16 polyclonal antibody