TTC5 polyclonal antibody
  • TTC5 polyclonal antibody

TTC5 polyclonal antibody

Ref: AB-PAB28298
TTC5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TTC5.
Información adicional
Size 100 uL
Gene Name TTC5
Gene Alias Strap
Gene Description tetratricopeptide repeat domain 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GALTHCRNKVSLQNLSMVLRQLRTDTEDEHSHHVMDSVRQAKLAVQMDVHDGRSWYILGNSYLSLYFSTGQNPKISQQALSAYAQAEKVDRKASSNPDL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant TTC5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 91875
Iso type IgG

Enviar un mensaje


TTC5 polyclonal antibody

TTC5 polyclonal antibody