TRPV2 polyclonal antibody
  • TRPV2 polyclonal antibody

TRPV2 polyclonal antibody

Ref: AB-PAB28296
TRPV2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TRPV2.
Información adicional
Size 100 uL
Gene Name TRPV2
Gene Alias MGC12549|VRL|VRL-1|VRL1
Gene Description transient receptor potential cation channel, subfamily V, member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RGKLDFGSGLPPMESQFQGEDRKFAPQIRVNLNYRKGTGASQPDPNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant TRPV2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51393
Iso type IgG

Enviar un mensaje


TRPV2 polyclonal antibody

TRPV2 polyclonal antibody