PEX19 polyclonal antibody
  • PEX19 polyclonal antibody

PEX19 polyclonal antibody

Ref: AB-PAB28292
PEX19 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PEX19.
Información adicional
Size 100 uL
Gene Name PEX19
Gene Alias D1S2223E|HK33|PMP1|PMPI|PXF|PXMP1
Gene Description peroxisomal biogenesis factor 19
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant PEX19.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5824
Iso type IgG

Enviar un mensaje


PEX19 polyclonal antibody

PEX19 polyclonal antibody