ESRRG polyclonal antibody
  • ESRRG polyclonal antibody

ESRRG polyclonal antibody

Ref: AB-PAB28291
ESRRG polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ESRRG.
Información adicional
Size 100 uL
Gene Name ESRRG
Gene Alias DKFZp781L1617|ERR3|FLJ16023|KIAA0832|NR3B3
Gene Description estrogen-related receptor gamma
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPK
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant ESRRG.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2104
Iso type IgG

Enviar un mensaje


ESRRG polyclonal antibody

ESRRG polyclonal antibody