KIAA0408 polyclonal antibody
  • KIAA0408 polyclonal antibody

KIAA0408 polyclonal antibody

Ref: AB-PAB28278
KIAA0408 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA0408.
Información adicional
Size 100 uL
Gene Name KIAA0408
Gene Alias FLJ43995|RP3-403A15.2
Gene Description KIAA0408
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq SCGFERTTRNEKLAAKTDEFNRTVFRTDRNCQAIQQNHSCSKSSEDLKPCDTSSTHTGSISQSNDVSGIWKTNAHMPVPMENVPDNPTKKS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant KIAA0408.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9729
Iso type IgG

Enviar un mensaje


KIAA0408 polyclonal antibody

KIAA0408 polyclonal antibody