ANKRD50 polyclonal antibody
  • ANKRD50 polyclonal antibody

ANKRD50 polyclonal antibody

Ref: AB-PAB28277
ANKRD50 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANKRD50.
Información adicional
Size 100 uL
Gene Name ANKRD50
Gene Alias KIAA1223
Gene Description ankyrin repeat domain 50
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq CKIMIPSAQQEIGRSQQQFLIHQQSGEQKKRNGIMTNPNYHLQSNQVFLGRVSVPRTMQDRGHQEVLEGYPSSETELSLKQALKLQIEGSDPSFN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant ANKRD50.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57182
Iso type IgG

Enviar un mensaje


ANKRD50 polyclonal antibody

ANKRD50 polyclonal antibody