DRGX polyclonal antibody
  • DRGX polyclonal antibody

DRGX polyclonal antibody

Ref: AB-PAB28276
DRGX polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DRGX.
Información adicional
Size 100 uL
Gene Name DRGX
Gene Alias DRG11|PRRXL1
Gene Description dorsal root ganglia homeobox
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PMGLSFLPTYGCQSNRTASVATLRMKAREHSEAVLQSANLLPSTSSSPGPVAKPAPPDGSQEKTSPTKEQSEAEKSV
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant DRGX.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 644168
Iso type IgG

Enviar un mensaje


DRGX polyclonal antibody

DRGX polyclonal antibody