TUBGCP6 polyclonal antibody
  • TUBGCP6 polyclonal antibody

TUBGCP6 polyclonal antibody

Ref: AB-PAB28275
TUBGCP6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TUBGCP6.
Información adicional
Size 100 uL
Gene Name TUBGCP6
Gene Alias GCP6
Gene Description tubulin, gamma complex associated protein 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LDLLVQLAGSGPPQVLPRKRDYFLNNKHVGRNVPYSGYDCDDLSVFEMDVQSLISREECLCHSMIQETLQVMEAAPGTGLPTVGLFSFGDP
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant TUBGCP6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 85378
Iso type IgG

Enviar un mensaje


TUBGCP6 polyclonal antibody

TUBGCP6 polyclonal antibody