FAM82B polyclonal antibody
  • FAM82B polyclonal antibody

FAM82B polyclonal antibody

Ref: AB-PAB28261
FAM82B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM82B.
Información adicional
Size 100 uL
Gene Name FAM82B
Gene Alias CGI-90|FLJ20665|RMD-1|RMD1
Gene Description family with sequence similarity 82, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq RLARASRDVAQLSRTSEEEKKLLVYEALEYAKRALEKNESSFASHKWYAICLSDVGDYEGIKAKIANAYIIKEHFEKAIELNPKDATSIHL
Form Liquid
Recomended Dilution Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/ml)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant FAM82B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51115
Iso type IgG

Enviar un mensaje


FAM82B polyclonal antibody

FAM82B polyclonal antibody