LOC100130988 polyclonal antibody
  • LOC100130988 polyclonal antibody

LOC100130988 polyclonal antibody

Ref: AB-PAB28260
LOC100130988 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LOC100130988.
Información adicional
Size 100 uL
Gene Name LOC100130988
Gene Alias -
Gene Description hypothetical protein LOC100130988
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ANIPGYTGKVHFTATHPANSNIPSTTPSPDSELHRVFQKEMAVDLFRHQAPLSRLVTTVRPYNPFNKKDKETIDY
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant LOC100130988.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 100130988
Iso type IgG

Enviar un mensaje


LOC100130988 polyclonal antibody

LOC100130988 polyclonal antibody