RBM45 polyclonal antibody
  • RBM45 polyclonal antibody

RBM45 polyclonal antibody

Ref: AB-PAB28244
RBM45 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RBM45.
Información adicional
Size 100 uL
Gene Name RBM45
Gene Alias DRB1|FLJ44612|MGC42237
Gene Description RNA binding motif protein 45
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq VDSLDEPPNSRIFLVISKYTPESVLRERFSPFGDIQDIWVVRDKHTKESKGIAFVKFARSSQACRAMEEMHGQCLGPNDTKPIKVFIAQSRSSGSHRDVEDEELTRIFVMIPKSYTEE
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/ml)
Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant RBM45.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 129831
Iso type IgG

Enviar un mensaje


RBM45 polyclonal antibody

RBM45 polyclonal antibody