EFCAB10 polyclonal antibody
  • EFCAB10 polyclonal antibody

EFCAB10 polyclonal antibody

Ref: AB-PAB28243
EFCAB10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EFCAB10.
Información adicional
Size 100 uL
Gene Name EFCAB10
Gene Alias -
Gene Description EF-hand calcium binding domain 10
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NIVAMFEMMDSSGRGTISFVQYKEALKTLGLCTEDEDLQDDGHKITLDKFKEEVNKRMKEIWSAF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant EFCAB10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 100130771
Iso type IgG

Enviar un mensaje


EFCAB10 polyclonal antibody

EFCAB10 polyclonal antibody