OR10S1 polyclonal antibody
  • OR10S1 polyclonal antibody

OR10S1 polyclonal antibody

Ref: AB-PAB28241
OR10S1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OR10S1.
Información adicional
Size 100 uL
Gene Name OR10S1
Gene Alias OR11-279
Gene Description olfactory receptor, family 10, subfamily S, member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MTSRSVCEKMTMTTENPNQTVVSHFFLEGLRYTAKHSSL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant OR10S1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 219873
Iso type IgG

Enviar un mensaje


OR10S1 polyclonal antibody

OR10S1 polyclonal antibody