SALL3 polyclonal antibody
  • SALL3 polyclonal antibody

SALL3 polyclonal antibody

Ref: AB-PAB28233
SALL3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SALL3.
Información adicional
Size 100 uL
Gene Name SALL3
Gene Alias ZNF796
Gene Description sal-like 3 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AYDDKNAETLSSYDDDMDENSMEDDAELKDAATDPAKPLLSYAGSCPPSPPSVISSIAALENQMKMIDSVMSCQQLTGLKSVENGSGE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant SALL3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 27164
Iso type IgG

Enviar un mensaje


SALL3 polyclonal antibody

SALL3 polyclonal antibody