OR14K1 polyclonal antibody
  • OR14K1 polyclonal antibody

OR14K1 polyclonal antibody

Ref: AB-PAB28232
OR14K1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OR14K1.
Información adicional
Size 100 uL
Gene Name OR14K1
Gene Alias OR1-39|OR1.5.9|OR5AY1
Gene Description olfactory receptor, family 14, subfamily K, member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DHRLHMAMYFFLRHLSFLDLCLISATVPKSILNSVASTDS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant OR14K1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 343170
Iso type IgG

Enviar un mensaje


OR14K1 polyclonal antibody

OR14K1 polyclonal antibody