P2RY11 polyclonal antibody
  • P2RY11 polyclonal antibody

P2RY11 polyclonal antibody

Ref: AB-PAB28230
P2RY11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant P2RY11.
Información adicional
Size 100 uL
Gene Name P2RY11
Gene Alias P2Y11
Gene Description purinergic receptor P2Y, G-protein coupled, 11
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VLNVDARRRWSTRCPSFADIAQATAALELGPYVGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATAAPKPSEPQSRELSQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human P2RY11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5032
Iso type IgG

Enviar un mensaje


P2RY11 polyclonal antibody

P2RY11 polyclonal antibody