C1orf210 polyclonal antibody
  • C1orf210 polyclonal antibody

C1orf210 polyclonal antibody

Ref: AB-PAB28229
C1orf210 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C1orf210.
Información adicional
Size 100 uL
Gene Name C1orf210
Gene Alias MGC52423
Gene Description chromosome 1 open reading frame 210
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq RYHASYRHRPLPETGRGGRPQVAEDEDDDGFIEDNYIQPGTGELGTEGSRDHF
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/ml)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant C1orf210.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 149466
Iso type IgG

Enviar un mensaje


C1orf210 polyclonal antibody

C1orf210 polyclonal antibody