C6orf170 polyclonal antibody
  • C6orf170 polyclonal antibody

C6orf170 polyclonal antibody

Ref: AB-PAB28228
C6orf170 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C6orf170.
Información adicional
Size 100 uL
Gene Name C6orf170
Gene Alias C6orf171|FLJ30899|FLJ34235|bA301B7.2|bA57L9.1|dJ310J6.1
Gene Description chromosome 6 open reading frame 170
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq SVERNHVLVRINLVGGPLERILPPRLLEKSDNPYPWPMFSSYPLPNCYLSDITRNAGIKQDNDLDKLLLCLKISDKQTEWIENCQRQFCKMMKAKPDIISGEALIELLEKFVLHLTESPSECYFPSVEYTATDANVKNE
Form Liquid
Recomended Dilution Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/ml)
Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant C6orf170.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 221322
Iso type IgG

Enviar un mensaje


C6orf170 polyclonal antibody

C6orf170 polyclonal antibody