TAPBP polyclonal antibody
  • TAPBP polyclonal antibody

TAPBP polyclonal antibody

Ref: AB-PAB28223
TAPBP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TAPBP.
Información adicional
Size 100 uL
Gene Name TAPBP
Gene Alias NGS17|TAPA|TPN|TPSN|tapasin
Gene Description TAP binding protein (tapasin)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QEGTYLATIHLPYLQGQVTLELAVYKPPKVSLMPATLARAAPGEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHSDGSVSLSGHLQPPPVTTEQHGARYACRIHHPS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant TAPBP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6892
Iso type IgG

Enviar un mensaje


TAPBP polyclonal antibody

TAPBP polyclonal antibody