RPS13 polyclonal antibody
  • RPS13 polyclonal antibody

RPS13 polyclonal antibody

Ref: AB-PAB28218
RPS13 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RPS13.
Información adicional
Size 100 uL
Gene Name RPS13
Gene Alias -
Gene Description ribosomal protein S13
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq RSVPTWLKLTSDDVKEQIYKLAKKGLTPSQIGVILRDSHGVAQVRFVTGNKILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIESRIHRLARYYKTKRVLPPNWKYESSTA
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Immunofluorescence (0.25-2 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RPS13.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 6207
Iso type IgG

Enviar un mensaje


RPS13 polyclonal antibody

RPS13 polyclonal antibody