TNFSF13 polyclonal antibody
  • TNFSF13 polyclonal antibody

TNFSF13 polyclonal antibody

Ref: AB-PAB28217
TNFSF13 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TNFSF13.
Información adicional
Size 100 uL
Gene Name TNFSF13
Gene Alias APRIL|CD256|TALL2|TRDL-1|UNQ383/PRO715|ligand
Gene Description tumor necrosis factor (ligand) superfamily, member 13
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LEAWENGERSRKRRAVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TNFSF13.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 8741
Iso type IgG

Enviar un mensaje


TNFSF13 polyclonal antibody

TNFSF13 polyclonal antibody