ALG11 polyclonal antibody
  • ALG11 polyclonal antibody

ALG11 polyclonal antibody

Ref: AB-PAB28209
ALG11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ALG11.
Información adicional
Size 100 uL
Gene Name ALG11
Gene Alias GT8|KIAA0266|UTP14C
Gene Description asparagine-linked glycosylation 11, alpha-1,2-mannosyltransferase homolog (yeast)
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DDELRVNQLRRLSEDLGVQEYVEFKINIPFDELKNYLSEATIGLHTMWNEHFGIGVVECMAAGTIILAHNSGGPKLDIVVPHEGDITGFLAESEEDYAETIAHILSMSAEKRLQIRKSARASVSRFSDQEFEVTFLSSVEKLFK
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant ALG11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 440138
Iso type IgG

Enviar un mensaje


ALG11 polyclonal antibody

ALG11 polyclonal antibody