MCCD1 polyclonal antibody
  • MCCD1 polyclonal antibody

MCCD1 polyclonal antibody

Ref: AB-PAB28206
MCCD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MCCD1.
Información adicional
Size 100 uL
Gene Name MCCD1
Gene Alias -
Gene Description mitochondrial coiled-coil domain 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SQNPKASMEEQTNSRGNGKMTSPPRGPGTHRTAELARAEELLEQQLELYQALLEGQEGAWEAQALVLKIQKLKEQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant MCCD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 401250
Iso type IgG

Enviar un mensaje


MCCD1 polyclonal antibody

MCCD1 polyclonal antibody