DDX60L polyclonal antibody
  • DDX60L polyclonal antibody

DDX60L polyclonal antibody

Ref: AB-PAB28195
DDX60L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DDX60L.
Información adicional
Size 100 uL
Gene Name DDX60L
Gene Alias DKFZp781D1175|FLJ13468|FLJ31033|FLJ39050
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 60-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QEPHLNLGDSIRRDYEDLWNVVSHLVKEFNLGKSFPLRTTRRHFLRQEKSVIQEISLEKMPSVGFIPMTSAVIDEFVGDMMKDL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant DDX60L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 91351
Iso type IgG

Enviar un mensaje


DDX60L polyclonal antibody

DDX60L polyclonal antibody