WDR46 polyclonal antibody
  • WDR46 polyclonal antibody

WDR46 polyclonal antibody

Ref: AB-PAB28194
WDR46 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant WDR46.
Información adicional
Size 100 uL
Gene Name WDR46
Gene Alias BING4|C6orf11|FP221
Gene Description WD repeat domain 46
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq LDWVTKKLMCEINVMEAVRDIRFLHSEALLAVAQNRWLHIYDNQGIELHCIRRCDRVTRLEFLPFHFLLATASETGFLTYLDVSVGKIVAALNARAGRLDVMSQNPYNAVIHL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant WDR46.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9277
Iso type IgG

Enviar un mensaje


WDR46 polyclonal antibody

WDR46 polyclonal antibody