C1orf167 polyclonal antibody
  • C1orf167 polyclonal antibody

C1orf167 polyclonal antibody

Ref: AB-PAB28192
C1orf167 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C1orf167.
Información adicional
Size 100 uL
Gene Name C1orf167
Gene Alias DKFZp434E1410
Gene Description chromosome 1 open reading frame 167
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq WCEVVRDTGVLRAQHQAFQDGLRRRALGAVFATWREAQEVAAGAQEQRVAQASLARWRSCGQQGQEDGQQK
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C1orf167.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 284498
Iso type IgG

Enviar un mensaje


C1orf167 polyclonal antibody

C1orf167 polyclonal antibody