RLN3 polyclonal antibody
  • RLN3 polyclonal antibody

RLN3 polyclonal antibody

Ref: AB-PAB28156
RLN3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RLN3.
Información adicional
Size 100 uL
Gene Name RLN3
Gene Alias H3|RXN3|ZINS4|insl7
Gene Description relaxin 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq LALTKSPQAFYRGRPSWQGTPGVLRGSRDVLAGLSSSCCKWGCSKSEISSLC
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant RLN3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 117579
Iso type IgG

Enviar un mensaje


RLN3 polyclonal antibody

RLN3 polyclonal antibody