RPL5 polyclonal antibody
  • RPL5 polyclonal antibody

RPL5 polyclonal antibody

Ref: AB-PAB28155
RPL5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RPL5.
Información adicional
Size 100 uL
Gene Name RPL5
Gene Alias MGC117339|MSTP030
Gene Description ribosomal protein L5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RLLNRFGMDKIYEGQVEVTGDEYNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant RPL5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6125
Iso type IgG

Enviar un mensaje


RPL5 polyclonal antibody

RPL5 polyclonal antibody