PTCD2 polyclonal antibody
  • PTCD2 polyclonal antibody

PTCD2 polyclonal antibody

Ref: AB-PAB28151
PTCD2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PTCD2.
Información adicional
Size 100 uL
Gene Name PTCD2
Gene Alias FLJ12598
Gene Description pentatricopeptide repeat domain 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KLNSPESFKICTTLREEALLKGEILSRRASCFAVALALNQNEMAKAVSIFSQIMNPESIACINLNIIIHIQSNMLENLIKTLK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant PTCD2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79810
Iso type IgG

Enviar un mensaje


PTCD2 polyclonal antibody

PTCD2 polyclonal antibody