COL17A1 polyclonal antibody
  • COL17A1 polyclonal antibody

COL17A1 polyclonal antibody

Ref: AB-PAB28148
COL17A1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant COL17A1.
Información adicional
Size 100 uL
Gene Name COL17A1
Gene Alias BA16H23.2|BP180|BPAG2|FLJ60881|KIAA0204|LAD-1
Gene Description collagen, type XVII, alpha 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq DGTEVTERIVTETVTTRLTSLPPKGGTSNGYAKTASLGGGSRLEKQSLTHGSSGYINSTGSTRGHASTSSYRRAHSPASTLPNSPGSTFERKTHVTR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant COL17A1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1308
Iso type IgG

Enviar un mensaje


COL17A1 polyclonal antibody

COL17A1 polyclonal antibody