EARS2 polyclonal antibody
  • EARS2 polyclonal antibody

EARS2 polyclonal antibody

Ref: AB-PAB28146
EARS2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EARS2.
Información adicional
Size 100 uL
Gene Name EARS2
Gene Alias KIAA1970|MSE1
Gene Description glutamyl-tRNA synthetase 2, mitochondrial (putative)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq YQGSFILRLEDTDQTRVVPGAAENIEDMLEWAGIPPDESPRRGGPAGPYQQSQRLELYAQATEALLKTGAAYPCFCSPQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant EARS2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 124454
Iso type IgG

Enviar un mensaje


EARS2 polyclonal antibody

EARS2 polyclonal antibody