CCDC19 polyclonal antibody
  • CCDC19 polyclonal antibody

CCDC19 polyclonal antibody

Ref: AB-PAB28144
CCDC19 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC19.
Información adicional
Size 100 uL
Gene Name CCDC19
Gene Alias NESG1
Gene Description coiled-coil domain containing 19
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq KEATMDAVMTRKKIMKQKEMVWNNNKKLSDLEEVAKERAQNLLQRANKLRMEQEEELKDMSKIILNAKCHAIRDAQILEKQQI
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant CCDC19.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 25790
Iso type IgG

Enviar un mensaje


CCDC19 polyclonal antibody

CCDC19 polyclonal antibody