RGL3 polyclonal antibody
  • RGL3 polyclonal antibody

RGL3 polyclonal antibody

Ref: AB-PAB28142
RGL3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RGL3.
Información adicional
Size 100 uL
Gene Name RGL3
Gene Alias FLJ00153|FLJ32585|MGC126805|MGC138163
Gene Description ral guanine nucleotide dissociation stimulator-like 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VEIKKTAVQDLSFNKNLRAVVSVLGSWLQDHPQDFRDHPAHSDLGSVRTFLGWAAPGSAEAQKAEKLLED
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant RGL3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57139
Iso type IgG

Enviar un mensaje


RGL3 polyclonal antibody

RGL3 polyclonal antibody